PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_018036-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 359aa    MW: 39285.3 Da    PI: 6.7279
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_018036-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.4e-191562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lvd+++++G g+W++ ++  g++R++k+c++rw +yl
  AHYPO_018036-RA 15 KGPWTPEEDKKLVDYIQLHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding51.22.9e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
  AHYPO_018036-RA  68 RGKFSDDEQQTIINLHSVLGNK-WSSIATHLP-GRTDNEIKNFWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-25665IPR009057Homeodomain-like
PROSITE profilePS5129417.8061062IPR017930Myb domain
SuperFamilySSF466891.17E-3012109IPR009057Homeodomain-like
SMARTSM007171.8E-151464IPR001005SANT/Myb domain
PfamPF002497.8E-181562IPR001005SANT/Myb domain
CDDcd001672.20E-121762No hitNo description
PROSITE profilePS5129426.52963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2666117IPR009057Homeodomain-like
SMARTSM007173.7E-1567115IPR001005SANT/Myb domain
PfamPF002495.5E-1568113IPR001005SANT/Myb domain
CDDcd001673.08E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MMGRSPCSDE NGLKKGPWTP EEDKKLVDYI QLHGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSDDEQQTII NLHSVLGNKW SSIATHLPGR TDNEIKNFWN THLKKKLLQM  120
GIDPVTHRPR TDLNLLANLP QLLVAANLSN SLMMNSTSTI NGIPSTFEDT LRLIDSDPTQ  180
LAKIHILHNM LQVLGQTSSN DTPCVSSQIT NLLCNSTLPF QNRLNHNNDL INGAISQFPG  240
SLVSSSFETP DVLQLFGSKN GCQSSSNDKE IGGEFLTADS LMPGLVPASP DHCSSKPINQ  300
KVDCTIMSTN PSSATTPTAD PFEIAAGNWS SDLIDVAAHS YWTDIIDQAS SPSWPISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010671094.11e-173PREDICTED: transcription factor MYB39
TrEMBLA0A0J8CSV01e-173A0A0J8CSV0_BETVU; Uncharacterized protein
STRINGVIT_16s0039g01710.t011e-120(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.25e-90myb domain protein 9